DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and rnf185

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_998202.1 Gene:rnf185 / 406310 ZFINID:ZDB-GENE-040426-1977 Length:194 Species:Danio rerio


Alignment Length:214 Identity:118/214 - (55%)
Similarity:141/214 - (65%) Gaps:23/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICL 129
            |.|:....|::|.|..|  .:.|..|...||   ||                 |.||.:||||||
Zfish     3 SAAASESSSSSSSSSAG--AANGQSAGESGG---GG-----------------AQDSTFECNICL 45

  Fly   130 DTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPP 194
            ||:||||:|:||||||||||||||.|||||::||||||.:.:|||||||||.||.|:|||.|.||
Zfish    46 DTSKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPP 110

  Fly   195 RPAGQRTEPDPVPGFPGFGFGD-GFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGTRQYEDEQT 258
            ||.|||.||:...||.|||||| ||.|||||||||||...:..|..:.|||.|..||.|:.|||.
Zfish   111 RPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAAPGTPQHTDEQF 175

  Fly   259 LSKLFSYLAVVWILWLFYA 277
            ||:||.::|::.:.||..|
Zfish   176 LSRLFLFVALLIMFWLLIA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 38/44 (86%)
rnf185NP_998202.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 10/33 (30%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 31..82 41/70 (59%)
RING 40..85 CDD:238093 38/44 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..126 22/33 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587025
Domainoid 1 1.000 135 1.000 Domainoid score I4932
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 236 1.000 Inparanoid score I3360
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm26352
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - LDO PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.