DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and rnf20

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001243104.1 Gene:rnf20 / 402838 ZFINID:ZDB-GENE-130404-2 Length:1013 Species:Danio rerio


Alignment Length:178 Identity:41/178 - (23%)
Similarity:68/178 - (38%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNSTASELKKSNTSYSFTGD 82
            |..:.:..::...:.|.:..:.::...|  |....:||.:...:..||.:.| |:|..:.....|
Zfish   861 GLRTQALEMNKRKAQDSVLLSEEVRTQL--EGVQQRLRSVREEVIENSISRE-KESFNARRAQED 922

  Fly    83 YLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYE----------CNICLDTAKDAVV 137
            ......|.:              || :|..|.....|:.|.|          |..|....||||:
Zfish   923 ISKLRRKIE--------------KA-KKPAENIRNGDEILNEEINEYKARLTCPCCNSRVKDAVL 972

  Fly   138 SMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQ 185
            :.|.|:||:.|:.....||  ::.||.|.||         :|.|..|:
Zfish   973 TKCFHVFCFECVKTRYDTR--QRKCPKCNAA---------FGANDFHR 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 18/54 (33%)
rnf20NP_001243104.1 Smc <269..>959 CDD:224117 20/115 (17%)
RING 959..1002 CDD:238093 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.