DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and Rnf185

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001019442.1 Gene:Rnf185 / 360967 RGDID:1564777 Length:192 Species:Rattus norvegicus


Alignment Length:217 Identity:118/217 - (54%)
Similarity:139/217 - (64%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECN 126
            |:.|.::|    |:|        :||......|....||                  .||.:|||
  Rat     6 PSASASTE----NSS--------AGGPSGSSNGTGESGG------------------QDSTFECN 40

  Fly   127 ICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNK 191
            ||||||||||:|:||||||||||||||.|||||::||||||.:.:|||||||||.||.|:|||.|
  Rat    41 ICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREK 105

  Fly   192 VPPRPAGQRTEPDPVPGFPGFGFGD-GFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGTRQYED 255
            .||||.|||.||:...||.|||||| ||.|||||||||||...:..|..:.|||.|..||.||.|
  Rat   106 TPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVD 170

  Fly   256 EQTLSKLFSYLAVVWILWLFYA 277
            ||.||:||.::|:|.:.||..|
  Rat   171 EQFLSRLFLFVALVIMFWLLIA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 39/44 (89%)
Rnf185NP_001019442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 8/35 (23%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000250|UniProtKB:Q96GF1 29..80 40/68 (59%)
RING-HC_RNF185 38..80 CDD:319658 36/41 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 21/32 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346068
Domainoid 1 1.000 138 1.000 Domainoid score I4725
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 239 1.000 Inparanoid score I3278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm46329
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - LDO PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.750

Return to query results.
Submit another query.