DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and brl2

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_587845.1 Gene:brl2 / 2539307 PomBaseID:SPCC970.10c Length:680 Species:Schizosaccharomyces pombe


Alignment Length:173 Identity:40/173 - (23%)
Similarity:70/173 - (40%) Gaps:55/173 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYL 84
            ||..||:.|  ..:|:::.:...:                  ..|:|.::|:...:..|.:.|.|
pombe   548 SSQKSTIQN--LEEKVSYLQQFMD------------------KNNATLTDLEFQCSDLSSSIDIL 592

  Fly    85 SGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADD-------------SLYECNIC-LDTAKDA 135
            |   |.|                .|.:|||....|.             ::.:|::| .:..||.
pombe   593 S---KQD----------------EEHEKEKRKLKDTGVSTSAEELKTFRAMCKCSVCNFERWKDR 638

  Fly   136 VVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLY 178
            ::|:|||.||:.|:.:.:.||..|  ||:|........|||::
pombe   639 IISLCGHGFCYQCIQKRIETRQRR--CPICGRGFGASDVIPIH 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 17/45 (38%)
brl2NP_587845.1 BRE1 433..525 CDD:285810
RING 627..666 CDD:214546 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.