DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and brl1

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_588497.1 Gene:brl1 / 2539102 PomBaseID:SPCC1919.15 Length:692 Species:Schizosaccharomyces pombe


Alignment Length:84 Identity:18/84 - (21%)
Similarity:33/84 - (39%) Gaps:13/84 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KANEKDKEKE------HTADDSLY----ECNIC-LDTAKDAVVSMCGHLFCWPCLHQWLLTRPNR 159
            ||:...||..      .|.:..:|    :|::| ....|..::..|||.||..|:..:.  ....
pombe   610 KASYNKKESHLINQAYETQEAQVYKGMLKCSVCNFSNWKSKLIPNCGHAFCSNCMEPFY--EHKT 672

  Fly   160 KLCPVCKAAVDKDKVIPLY 178
            ..||.|:.......::.::
pombe   673 STCPQCETPFSVSDILTIH 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 12/45 (27%)
brl1NP_588497.1 MT 227..>315 CDD:289543
BRE1 446..540 CDD:285810
RING 638..682 CDD:238093 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.