DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd1 and CG44271

DIOPT Version :10

Sequence 1:NP_573076.1 Gene:sordd1 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001285689.1 Gene:CG44271 / 19835868 FlyBaseID:FBgn0265257 Length:106 Species:Drosophila melanogaster


Alignment Length:57 Identity:20/57 - (35%)
Similarity:26/57 - (45%) Gaps:11/57 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNR-KLCPVCK 166
            |:...|      |.|.||:......|.:.|||:||..|    |.|..|: ..||:||
  Fly    49 DRNNGH------YLCPICMSLPDHPVATTCGHIFCKEC----LTTALNQLHYCPLCK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd1NP_573076.1 RING-HC_RNF185 123..179 CDD:438402 18/45 (40%)
CG44271NP_001285689.1 COG5152 <12..94 CDD:227481 18/54 (33%)
RING_Ubox 57..>99 CDD:473075 17/43 (40%)

Return to query results.
Submit another query.