DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and Rnf185

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_663330.2 Gene:Rnf185 / 193670 MGIID:1922078 Length:228 Species:Mus musculus


Alignment Length:212 Identity:116/212 - (54%)
Similarity:138/212 - (65%) Gaps:19/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLDT 131
            |:...|..::.:.|.:..:||......|....||                  .||.:||||||||
Mouse    35 AAMASKGPSASASTENSNAGGPSGSSNGTGESGG------------------QDSTFECNICLDT 81

  Fly   132 AKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPRP 196
            |||||:|:||||||||||||||.|||||::||||||.:.:|||||||||.||.|:|||.|.||||
Mouse    82 AKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRP 146

  Fly   197 AGQRTEPDPVPGFPGFGFGD-GFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGTRQYEDEQTLS 260
            .|||.||:...||.|||||| ||.|||||||||||...:..|..:.|||.|..||.||.|||.||
Mouse   147 QGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLS 211

  Fly   261 KLFSYLAVVWILWLFYA 277
            :||.::|:|.:.||..|
Mouse   212 RLFLFVALVIMFWLLIA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 39/44 (89%)
Rnf185NP_663330.2 RING 74..119 CDD:238093 39/44 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842610
Domainoid 1 1.000 138 1.000 Domainoid score I4825
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 239 1.000 Inparanoid score I3348
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm44230
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - LDO PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.780

Return to query results.
Submit another query.