DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and rfp-1

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001022700.1 Gene:rfp-1 / 176180 WormBaseID:WBGene00007008 Length:837 Species:Caenorhabditis elegans


Alignment Length:80 Identity:22/80 - (27%)
Similarity:32/80 - (40%) Gaps:19/80 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVD 170
            :||.:.||        ...|..|....||.::..|.||||..|:.....||  ::.||.|.:.  
 Worm   774 EANRQMKE--------TLTCPSCKTRPKDCIMLKCYHLFCETCIKTMYDTR--QRKCPKCNSN-- 826

  Fly   171 KDKVIPLYGRNSTHQ 185
                   :|.|..|:
 Worm   827 -------FGANDFHR 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 15/44 (34%)
rfp-1NP_001022700.1 zf-C3HC4 785..823 CDD:278524 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.