DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and rnf-5

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_497830.1 Gene:rnf-5 / 175532 WormBaseID:WBGene00004381 Length:235 Species:Caenorhabditis elegans


Alignment Length:234 Identity:94/234 - (40%)
Similarity:118/234 - (50%) Gaps:62/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDTKANEKDKEKEHTADDSL-YECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            ::|||..::.......|:|. :|||||||.|||||||:||||||||||.|||.||||.::|||||
 Worm     3 SETKAPSEEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPVCK 67

  Fly   167 AAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGF-GDG---------FHMS 221
            :|:|.:||:|:|||.. ...|||.||||||.|||:||.| ..|.||.: |||         .|.|
 Worm    68 SAIDGNKVVPIYGRGG-DSSDPRKKVPPRPKGQRSEPPP-QSFAGFNWGGDGGMMGGGGPNVHFS 130

  Fly   222 FGIGA-----------------FPFGFITSTLNFGEPRPPAA----------NRGT--------- 250
            ||||.                 ||..|:.|....|.....||          |.||         
 Worm   131 FGIGTVNGLFPLMFMLPFIQGIFPLSFVASFFGNGNQGAAAAGGGNGGGNDGNDGTHAHTHGHTH 195

  Fly   251 -------------RQYEDEQTLSKLFSYLAVVWILWLFY 276
                         |..::|:.||.:|.|:....:.||.:
 Worm   196 GPRGHGESAAPGSRMAQEEEYLSNIFKYIGFFMLFWLLF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 36/44 (82%)
rnf-5NP_497830.1 RING 25..70 CDD:238093 36/44 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162504
Domainoid 1 1.000 96 1.000 Domainoid score I4598
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 161 1.000 Inparanoid score I2853
Isobase 1 0.950 - 0 Normalized mean entropy S2074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm14661
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - LDO PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.