DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8974 and Rnf20

DIOPT Version :9

Sequence 1:	NP_573076.1	Gene:	CG8974 / 32532	FlyBaseID:	FBgn0030693	Length:	277	Species:	Drosophila melanogaster
Sequence 2:	NP_001156735.1	Gene:	Rnf20 / 109331	MGIID:	1925927	Length:	973	Species:	Mus musculus

Alignment Length:	61	Identity:	21/61 - (34%)
Similarity:	30/61 - (49%)	Gaps:	11/61 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQ 185
            |..|....||||::.|.|:||:.|:.....||  ::.||.|.||         :|.|..|:
Mouse   920 CPCCNMRKKDAVLTKCFHVFCFECVKTRYDTR--QRKCPKCNAA---------FGANDFHR 969

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8974	NP_573076.1	RING	124..169	CDD:238093	17/43 (40%)
Rnf20	NP_001156735.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..37
		Smc	<41..394	CDD:224117
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	128..153
		PTZ00121	<320..934	CDD:173412	6/13 (46%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	507..620
		RING-HC_RNF20_like	918..963	CDD:319618	18/53 (34%)
		RING-HC finger (C3HC4-type)	920..958	CDD:319618	15/39 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R146
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030