DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8974 and rnf5

DIOPT Version :9

Sequence 1:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_003200552.1 Gene:rnf5 / 100537822 ZFINID:ZDB-GENE-100805-3 Length:205 Species:Danio rerio


Alignment Length:221 Identity:109/221 - (49%)
Similarity:137/221 - (61%) Gaps:34/221 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASELKKSNT------SYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYEC 125
            |:|.::|::      ...|.|   |||      |..|.||.:     .|:|:|:      :.:||
Zfish     3 AAEQQRSSSDGAAARGAGFPG---SGG------GAGPGGGAE-----GERDRER------ATFEC 47

  Fly   126 NICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRN 190
            |||||||:|||:|:||||||||||||||.|||:|:.||||||.:.:|||||||||.|:.|||||.
Zfish    48 NICLDTARDAVISLCGHLFCWPCLHQWLETRPSRQQCPVCKAGISRDKVIPLYGRGSSSQEDPRL 112

  Fly   191 KVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGEPRPPA-ANRGTRQYE 254
            |.||||.|||:||:....|.||| ..|||||||||||||||.|:..|...|...| |:.|..|..
Zfish   113 KTPPRPQGQRSEPESRGPFQGFG-DTGFHMSFGIGAFPFGFFTTVFNTNNPFHRADAHYGADQQA 176

  Fly   255 DEQT------LSKLFSYLAVVWILWL 274
            :|..      ...||.:||:.:..|:
Zfish   177 NENANNGNNWQDSLFLFLAIFFFFWI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8974NP_573076.1 RING 124..169 CDD:238093 37/44 (84%)
rnf5XP_003200552.1 PLN03208 45..>141 CDD:178747 68/96 (71%)
RING 46..91 CDD:238093 37/44 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.