DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhp and Brox

DIOPT Version :9

Sequence 1:NP_511168.3 Gene:Rhp / 32531 FlyBaseID:FBgn0026374 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001344171.1 Gene:Brox / 71678 MGIID:1918928 Length:411 Species:Mus musculus


Alignment Length:333 Identity:71/333 - (21%)
Similarity:130/333 - (39%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 YIDAIADMTDTRQASKTPSRDALGVALLFRYYNTLYYVERRFFPPDRNLGVYFEWYDSLTG-VPS 217
            :|:::.|.|   |.||                  |.|::.            |:|.|:|.| |||
Mouse    71 FINSVGDST---QESK------------------LRYIQN------------FKWTDTLQGHVPS 102

  Fly   218 CQRTIAFEKACTLFNLGGIYTQIGAR---HDRTTERGLDLAVDSFLRAAGVFRHIYDTFTNAPSM 279
            .|:...||.....||:...||:..:|   .:..||........|...|||:|:|:.:  ::.|.:
Mouse   103 AQQDAVFELISMGFNVALWYTKYASRLAGKENITEDEAKEVHRSLKIAAGIFKHLKE--SHIPKL 165

  Fly   280 --------DLKPQVLDVLVSLMLSQARECLFEK-LQLQ-----IEAMSHDCQAFRDLAGEAAQIS 330
                    ||:.:::|..:....::|:|....: ::|:     |.|:::|..:|...|      .
Mouse   166 LTPAEKGRDLEARLIDAYIIQCQAEAQEVTIARAIELKHAPGLIAALAYDTASFYQKA------D 224

  Fly   331 HEYNEMHKNIQANDTHTYLPECWAGLVPVKAELYKAFAHFYKARSIDATDEL-KASKSSQKNQES 394
            |..:.:.....|.         |...:.:|...|.|:|:.|..:::.|:|:. :|.:|.|:.::.
Mouse   225 HTLSSLEPAHSAK---------WRKYLHLKMCFYTAYAYCYHGQTLLASDKCGEAIRSLQEAEKL 280

  Fly   395 FIGNSQEVERITTADYGASDEASTSIANKLAHLKEALASIEEAQRLQRMCRFLKNKASLTEVMKE 459
            :    .|.|.: ..:||.: :.....|....||                  |.:...||   :|.
Mouse   281 Y----AEAEAL-CKEYGET-KGPGPTAKPSGHL------------------FFRKLGSL---VKN 318

  Fly   460 VHSKSQEE 467
            ...|.|.|
Mouse   319 TLDKCQRE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhpNP_511168.3 HR1_Rhophilin-1 34..118 CDD:212023
BRO1_Rhophilin 122..514 CDD:185767 71/333 (21%)
PDZ_signaling 570..642 CDD:238492
BroxNP_001344171.1 BRO1_Brox_like 4..356 CDD:185766 71/333 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.