DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Paf-AHalpha and atrnl1a

DIOPT Version :9

Sequence 1:	NP_525089.2	Gene:	Paf-AHalpha / 32529	FlyBaseID:	FBgn0025809	Length:	225	Species:	Drosophila melanogaster
Sequence 2:	XP_001331928.5	Gene:	atrnl1a / 792417	ZFINID:	ZDB-GENE-081028-60	Length:	1400	Species:	Danio rerio

Alignment Length:	106	Identity:	28/106 - (26%)
Similarity:	46/106 - (43%)	Gaps:	25/106 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   123 KLPNA--YIVLPSLLPRGQQPNKLREK---NAKINEVVNGLTKGL--------YRVQT-----VA 169
            |:|:|  |..||::.|.||...:...|   :.|:..|:.|.|...        |.:::     |.
Zfish   263 KVPSAESYWFLPNVKPDGQSLGRASHKAVVHGKLMWVIGGFTFNYSSFQMVMNYNLESSTWDVVP 327

  Fly   170 IDKGLVQTDG-SISHHD----MFDYKNLTNAGAKKILEPLY 205
            |:.|.:|..| |::.|.    ||..|  ..||...:.:.|:
Zfish   328 INGGPLQRYGHSLALHKDVIYMFGGK--LEAGFGNVTDELW 366

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Paf-AHalpha	NP_525089.2	PAF_acetylesterase_like	3..212	CDD:238858	28/106 (26%)
atrnl1a	XP_001331928.5	CUB	73..188	CDD:238001
		KELCH repeat	285..333	CDD:276965	9/47 (19%)
		Kelch_1	285..327	CDD:279660	6/41 (15%)
		Kelch_5	332..372	CDD:290565	10/37 (27%)
		KELCH repeat	335..382	CDD:276965	9/34 (26%)
		KELCH repeat	391..436	CDD:276965
		KELCH repeat	501..556	CDD:276965
		CLECT	768..896	CDD:295302
		PSI	911..961	CDD:279745
		EGF_Lam	1035..1080	CDD:238012
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1388
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900