DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and Tmem145

DIOPT Version :10

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001390131.1 Gene:Tmem145 / 330485 MGIID:3607779 Length:604 Species:Mus musculus


Alignment Length:59 Identity:15/59 - (25%)
Similarity:24/59 - (40%) Gaps:13/59 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAGAKK--ILEPLYDLLSQILNENEPE 218
            ::.:..:.:.||...|.|.|||           :|:.|  :...||.|...:|...|.|
Mouse   267 IFLLTLILLGKGFTVTRGRISH-----------SGSVKLSVYMTLYTLTHVVLLIYEAE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 12/51 (24%)
Tmem145NP_001390131.1 GpcrRhopsn4 157..411 CDD:462989 15/59 (25%)
PHA03247 <476..599 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.