DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and Tmem145

DIOPT Version :9

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_006540177.1 Gene:Tmem145 / 330485 MGIID:3607779 Length:604 Species:Mus musculus


Alignment Length:59 Identity:15/59 - (25%)
Similarity:24/59 - (40%) Gaps:13/59 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LYRVQTVAIDKGLVQTDGSISHHDMFDYKNLTNAGAKK--ILEPLYDLLSQILNENEPE 218
            ::.:..:.:.||...|.|.|||           :|:.|  :...||.|...:|...|.|
Mouse   267 IFLLTLILLGKGFTVTRGRISH-----------SGSVKLSVYMTLYTLTHVVLLIYEAE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 12/51 (24%)
Tmem145XP_006540177.1 GpcrRhopsn4 157..411 CDD:370872 15/59 (25%)
PHA03247 <476..599 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.