DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and Ice1

DIOPT Version :9

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_225143.5 Gene:Ice1 / 306665 RGDID:1309747 Length:2225 Species:Rattus norvegicus


Alignment Length:189 Identity:45/189 - (23%)
Similarity:60/189 - (31%) Gaps:61/189 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NKYFAPLHCLNFSI----------RDDCTEHVLWRIENGAL----DNVNPKIVVL-----HVGTN 100
            |:|...|..|...|          :..|.|....|.||..|    :.:..||..|     .:|| 
  Rat    30 NEYVEALIALKQKIINTDNLLTEYQKKCDELQFARRENSTLHHQVEQMLQKISPLQKCQEELGT- 93

  Fly   101 NVRNSAEEVAEGVLANVTKIRQKLPNAYI-VLPSLLPRGQQPNKLREKNAKINEVVNGLTKGLYR 164
             ::...||....:     |:.|.....|. |....|....|..||..|..|:.|.          
  Rat    94 -LKAELEEKKSSL-----KLYQDTHQEYARVKEECLRTDAQKKKLEAKVKKLEEA---------- 142

  Fly   165 VQTVAIDKGLVQTDGSISHHDMFDYKNLTNAGAKKILEPLYDLLSQILNE-----NEPE 218
                    .:.||.         |:|.|.|  .|||||..:....:.|:|     ||.|
  Rat   143 --------AVKQTQ---------DFKQLRN--EKKILEKEFRKTQERLDEFSKQKNEKE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 40/176 (23%)
Ice1XP_225143.5 DUF2031 <26..>180 CDD:299055 42/185 (23%)
DUF4201 53..185 CDD:290581 40/166 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.