DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and ATRNL1

DIOPT Version :9

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_997186.1 Gene:ATRNL1 / 26033 HGNCID:29063 Length:1379 Species:Homo sapiens


Alignment Length:94 Identity:18/94 - (19%)
Similarity:30/94 - (31%) Gaps:37/94 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AYIVLPSLLPRGQQPNKLREK---NAKINEVVNGLTKGLYRVQTVAIDKGLVQTDGSISHHDMFD 188
            :|.:||::.|......:...|   :.|...|:.|.|                           |:
Human   289 SYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYT---------------------------FN 326

  Fly   189 YKNLTNAGAKKILEPLYDLLSQILNENEP 217
            |.:.     :.:|.  |:|.|.|.|...|
Human   327 YSSF-----QMVLN--YNLESSIWNVGTP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 15/87 (17%)
ATRNL1NP_997186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
CUB 93..208 CDD:238001
DSL <235..280 CDD:302925
KELCH repeat 305..349 CDD:276965 14/78 (18%)
Kelch 1 316..365 12/67 (18%)
Kelch_5 352..392 CDD:290565
KELCH repeat 355..408 CDD:276965
Kelch 2 367..415
Kelch 3 427..475
Kelch_4 468..514 CDD:290154
Kelch 4 480..531
KELCH repeat 521..574 CDD:276965
Kelch 5 533..591
Kelch_5 581..614 CDD:290565
Kelch 6 592..638
CLECT_attractin_like 748..874 CDD:153067
PSI 889..938 CDD:279745
EGF_Lam 1013..1058 CDD:238012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1354..1379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.