DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and ICE1

DIOPT Version :9

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_056140.1 Gene:ICE1 / 23379 HGNCID:29154 Length:2266 Species:Homo sapiens


Alignment Length:226 Identity:44/226 - (19%)
Similarity:81/226 - (35%) Gaps:68/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DCIFETVQDTEAWNKYFA--PLHCLNFSIRDDCTEHVLWRIENGALDNVN-----PKIVVLHVGT 99
            ||    ..||:...|.|:  |.|          :||   :::...|:.::     |:   ..:|.
Human   652 DC----GNDTDITTKVFSTEPHH----------SEH---KLQTKTLNTLHLQSEPPE---CSIGG 696

  Fly   100 NNVRNSA-------------EEVAEGVLANVTKIRQKLPNAYIVLPSLLPRGQQPNKLREKNAKI 151
            ||:.||.             ::.:.|:  ..||:.:.|...:.:..|:..:..:..:...::.:|
Human   697 NNLENSLCALSPELGASNFNDQKSSGI--EYTKVVKGLTKIHSLPRSVFMKATKDGQCESQDPRI 759

  Fly   152 NEVVN--GLTKGLYRVQTVAIDKGLVQTDGSISHH-DMF------------DYKNLTNAGAKKIL 201
            ...:|  ..| .|...|...|..||.....:..|| |:.            :::..|:...:|.:
Human   760 ELTLNKPDFT-SLIGSQAALIKSGLGFVKSTSWHHSDLLRKGGEESLRAKSEHEQKTSHQLQKAM 823

  Fly   202 --------EPLYDLLSQILNENEPENDLTPS 224
                    .|..|||.:  |.|..|...|.|
Human   824 PFLQNRGPTPKPDLLRE--NNNPVEFKTTAS 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 39/212 (18%)
ICE1NP_056140.1 DUF2031 <27..>181 CDD:299055
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..259
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 591..623
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..955
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 977..1001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1107..1133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1295..1372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1467..1510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1543..1707
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1809..1902
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.