DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and Atrnl1

DIOPT Version :10

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_852080.3 Gene:Atrnl1 / 226255 MGIID:2147749 Length:1378 Species:Mus musculus


Alignment Length:112 Identity:21/112 - (18%)
Similarity:41/112 - (36%) Gaps:21/112 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AYIVLPSLLPRGQQPNKLREK---NAKINEVVNGLTKGLYRVQTV-------------AIDKGLV 175
            :|.:||::.|......:...|   :.|...|:.|.|......|.|             |:.:|.:
Mouse   288 SYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGAVSRGPL 352

  Fly   176 QTDG---SISHHDMFDYKNLTNAGAKKILEPL--YDLLSQILNENEP 217
            |..|   ::...::|.|..........:.:.|  :::.||..:...|
Mouse   353 QRYGHSLALYQENIFMYGGRMETSDGNVTDELWVFNVRSQSWSTKTP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 20/105 (19%)
Atrnl1NP_852080.3 CUB 92..207 CDD:238001
DSL 234..280 CDD:473190
NanM 302..597 CDD:442289 17/98 (17%)
KELCH repeat 304..352 CDD:276965 9/47 (19%)
Kelch 1 315..364 9/48 (19%)
KELCH repeat 354..407 CDD:276965 7/46 (15%)
Kelch 2 366..414 6/34 (18%)
Kelch 3 426..474
Kelch 4 479..530
KELCH repeat 520..573 CDD:276965
Kelch 5 532..590
Kelch 6 591..637
CLECT_attractin_like 747..873 CDD:153067
PSI 888..937 CDD:396154
EGF_Lam 1012..1057 CDD:238012
Interaction with MC4R. /evidence=ECO:0000269|PubMed:14531729 1287..1324
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1351..1378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.