DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Paf-AHalpha and Atrnl1

DIOPT Version :9

Sequence 1:	NP_525089.2	Gene:	Paf-AHalpha / 32529	FlyBaseID:	FBgn0025809	Length:	225	Species:	Drosophila melanogaster
Sequence 2:	NP_852080.3	Gene:	Atrnl1 / 226255	MGIID:	2147749	Length:	1378	Species:	Mus musculus

Alignment Length:	112	Identity:	21/112 - (18%)
Similarity:	41/112 - (36%)	Gaps:	21/112 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   127 AYIVLPSLLPRGQQPNKLREK---NAKINEVVNGLTKGLYRVQTV-------------AIDKGLV 175
            :|.:||::.|......:...|   :.|...|:.|.|......|.|             |:.:|.:
Mouse   288 SYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGAVSRGPL 352

  Fly   176 QTDG---SISHHDMFDYKNLTNAGAKKILEPL--YDLLSQILNENEP 217
            |..|   ::...::|.|..........:.:.|  :::.||..:...|
Mouse   353 QRYGHSLALYQENIFMYGGRMETSDGNVTDELWVFNVRSQSWSTKTP 399

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Paf-AHalpha	NP_525089.2	PAF_acetylesterase_like	3..212	CDD:238858	20/105 (19%)
Atrnl1	NP_852080.3	CUB	92..207	CDD:238001
		DSL	<234..279	CDD:302925
		KELCH repeat	304..352	CDD:276965	9/47 (19%)
		Kelch 1	315..364		9/48 (19%)
		Kelch_5	351..391	CDD:290565	5/39 (13%)
		KELCH repeat	354..407	CDD:276965	7/46 (15%)
		Kelch 2	366..414		6/34 (18%)
		Kelch 3	426..474
		Kelch_4	467..513	CDD:290154
		Kelch 4	479..530
		KELCH repeat	520..573	CDD:276965
		Kelch 5	532..590
		Kelch_5	580..613	CDD:290565
		Kelch 6	591..637
		CLECT_attractin_like	747..873	CDD:153067
		PSI	888..937	CDD:279745
		EGF_Lam	1012..1057	CDD:238012
		Interaction with MC4R. /evidence=ECO:0000269\|PubMed:14531729	1287..1324
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1351..1378
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1388
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900