DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and Ice1

DIOPT Version :9

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_659086.2 Gene:Ice1 / 218333 MGIID:2385865 Length:2241 Species:Mus musculus


Alignment Length:184 Identity:43/184 - (23%)
Similarity:58/184 - (31%) Gaps:51/184 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NKYFAPLHCLNFSI----------RDDCTEHVLWRIENGAL----DNVNPKIVVLHVGTNNVRNS 105
            |:|...|..|...|          :..|.|....|.||..|    :.:..||..|......:.:.
Mouse    30 NEYVEALIALKQKIINTDNLLTEYQKKCDELQFARRENSTLHHQVEQMLQKISPLQKCQEELGSL 94

  Fly   106 AEEVAEGVLANVTKIRQKLPNAYI-VLPSLLPRGQQPNKLREKNAKINEVVNGLTKGLYRVQTVA 169
            ..|:.|  ..:..|:.|.....|. |....|....|..||..|..|:.|.               
Mouse    95 KAELEE--KKSSLKLYQDTHQEYARVKEECLRTDAQKKKLEAKVKKLEEA--------------- 142

  Fly   170 IDKGLVQTDGSISHHDMFDYKNLTNAGAKKILEPLYDLLSQILNE-----NEPE 218
               .:.||.         |:|.|.|  .|||||..:....:.|:|     ||.|
Mouse   143 ---AVKQTQ---------DFKQLRN--EKKILEKEFKKTQERLDEFSKQKNEKE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 38/171 (22%)
Ice1NP_659086.2 DUF2031 <26..>180 CDD:299055 40/180 (22%)
DUF4201 53..185 CDD:290581 38/161 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 703..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 971..1119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1231..1328
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1419..1475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1543..1671
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1777..1800
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1812..1843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.