DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paf-AHalpha and MEGF8

DIOPT Version :10

Sequence 1:NP_525089.2 Gene:Paf-AHalpha / 32529 FlyBaseID:FBgn0025809 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001258867.1 Gene:MEGF8 / 1954 HGNCID:3233 Length:2845 Species:Homo sapiens


Alignment Length:57 Identity:16/57 - (28%)
Similarity:21/57 - (36%) Gaps:13/57 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTPLPDLDGDKRWHSIHRRFISDCREKDPDVIFLGDCIFETVQDTEAWNKYFAPLHC 63
            |||.|.....:........|.|.||::.|.  |..:|     ||. .|.:     ||
Human  1148 PTPAPGPPAPRCSRDCGCSFHSHCRKRGPG--FCDEC-----QDW-TWGE-----HC 1191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Paf-AHalphaNP_525089.2 PAF_acetylesterase_like 3..212 CDD:238858 16/57 (28%)
MEGF8NP_001258867.1 CUB 49..139 CDD:238001
NanM 227..531 CDD:442289
KELCH repeat 228..275 CDD:276965
Kelch 1 241..287
KELCH repeat 279..331 CDD:276965
Kelch 2 290..338
Kelch 3 346..399
Kelch 4 402..453
KELCH repeat 448..510 CDD:276965
Kelch 5 459..511
Kelch 6 525..575
PSI 950..998 CDD:396154
EGF_3 1078..1112 CDD:463759
EGF_Lam 1210..1259 CDD:238012
Kelch 7 1522..1570
NanM 1557..1858 CDD:442289
KELCH repeat 1566..1612 CDD:276965
Kelch 8 1580..1626
KELCH repeat 1620..1669 CDD:276965
Kelch 9 1632..1679
KELCH repeat 1672..1720 CDD:276965
Kelch 10 1685..1735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1726..1745
KELCH repeat 1785..1838 CDD:276965
Kelch 11 1796..1843
Kelch 12 1852..1898
EGF_CA 2180..2214 CDD:238011
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2523..2564
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2817..2845
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.