DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:268 Identity:87/268 - (32%)
Similarity:130/268 - (48%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VGQPF-----DPANSSPI--KIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLT 77
            |.||.     :.....||  .|...|:.|.||.  ::||||.:|..:.:. |||||:|:..||||
Zfish    19 VRQPLGWAAKESTTKKPIDGDIHEGIMQGVDAL--RWPWQVSIKTSSGEH-LCGGSLINKFWVLT 80

  Fly    78 AAHCTNGLSSIFLMFGTVDLFNANALNMTSNN----------IIIHPDYNDK--LNNDVSLIQLP 130
            ||||.....|.:::.|..|        .:||:          :|.|||.|.:  .||||:|::|.
Zfish    81 AAHCQIQARSHYVVLGQHD--------RSSNDGTVQVKEIAKVITHPDNNIQTLFNNDVTLLKLS 137

  Fly   131 EPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIY 195
            .|...::.:..:.|.......:.  |::....|:|.|:.|.  .:..|..|.:.|:..:.|..|:
Zfish   138 SPAQMTSLVSPVCLASSSSKIVP--GTLCVTTGWGRTKTEL--SARILQEATIPIVSQSQCKQIF 198

  Fly   196 GKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYAR 260
            |...:.:|.:||   .||..|:|.|||||||:..:..:  |.|:||.|:...| |....|..|||
Zfish   199 GASKITNSMICA---GGSGSSSCQGDSGGPLMCESSGV--WYQVGIVSWGNRD-CRVDFPLVYAR 257

  Fly   261 VSSFLGFI 268
            ||.|..:|
Zfish   258 VSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 80/242 (33%)
Tryp_SPc 38..271 CDD:238113 81/243 (33%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.