DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Prss41

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:281 Identity:76/281 - (27%)
Similarity:126/281 - (44%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHC 81
            |.::..|....|.:    .:|||.|.::..|::|||..|:..  ....||||::|..||||||||
Mouse    67 IKLLSMPCGRRNDT----RSRIVGGIESMQGRWPWQASLRLK--KSHRCGGSLLSRRWVLTAAHC 125

  Fly    82 TNGLSSIFLMFGTVDLFNANALNMTS----------------NNIIIHPDYNDKL-NNDVSLIQL 129
                   |..:...:.:......:||                .:||::.:  ||| ::|::|::|
Mouse   126 -------FRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSE--DKLKSHDLALLRL 181

  Fly   130 PEPLTFSANIQAI-----QLVGQYGDSIDYVGSVATIAGFGYTEDEY--LDYSETLLYAQVEIID 187
            ...:|::.:||.:     ....|:...       ..:.|:|..:::.  |.....|...||.|::
Mouse   182 ASSVTYNKDIQPVCVQPSTFTSQHQPR-------CWVTGWGVLQEDLKPLPPPYHLREVQVSILN 239

  Fly   188 NADCVAIYG----KYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAED 248
            |:.|..::.    .:::.....||...||| ..||:|||||||:.....:  |.||||.|:..  
Mouse   240 NSRCQELFEIFSLHHLITKDVFCAGAEDGS-ADTCSGDSGGPLVCNMDGL--WYQIGIVSWGI-- 299

  Fly   249 QC-TYRLPSGYARVSSFLGFI 268
            .| ...||..|..||.:..:|
Mouse   300 GCGRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 72/259 (28%)
Tryp_SPc 38..271 CDD:238113 72/260 (28%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.