DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Prss32

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:268 Identity:85/268 - (31%)
Similarity:137/268 - (51%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCT 82
            ||.|:|         :...|||||.||:||::||||.::.:...  :||||:|::.||||||||.
Mouse    43 SVCGRP---------RTSGRIVSGQDAQLGRWPWQVSVRENGAH--VCGGSLIAEDWVLTAAHCF 96

  Fly    83 N---GLSSIFLMFGTVDLF----NANALNMTSNNIIIHPDY--NDKLNNDVSLIQLPEPLTFSAN 138
            |   .||...::.||:..:    ....|...: ..|.||.|  ::..:.|::|:||..|::|:..
Mouse    97 NQGQSLSIYTVLLGTISSYPEDNEPKELRAVA-QFIKHPSYSADEHSSGDIALVQLASPISFNDY 160

  Fly   139 IQAIQLVGQYGDSIDYVGSVATIAGFGYT-EDEYLDYSETLLYAQVEIIDNADCVAIYGKY---- 198
            :..:.| .:.||.:| .|::..:.|:|:. .::.|....||...||.:||...|...|.:.    
Mouse   161 MLPVCL-PKPGDPLD-PGTMCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPG 223

  Fly   199 ---VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYAR 260
               |:::..:|| ||.......|.|||||||:.....:  |.|.|:.|: ..|...::.|..|..
Mouse   224 TEPVILEGMLCA-GFQEGKKDACNGDSGGPLVCDINDV--WIQAGVVSW-GSDCALFKRPGVYTN 284

  Fly   261 VSSFLGFI 268
            ||.::.:|
Mouse   285 VSVYISWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 80/247 (32%)
Tryp_SPc 38..271 CDD:238113 80/248 (32%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 80/247 (32%)
Tryp_SPc 54..295 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.