DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and ST14

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:264 Identity:72/264 - (27%)
Similarity:116/264 - (43%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHC---TNGLS-------SIFLM 91
            |:|.|:||..|::||||.| .......:||.|:||..|:::||||   ..|..       :.|| 
Human   614 RVVGGTDADEGEWPWQVSL-HALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFL- 676

  Fly    92 FGTVDLFNANALNMTS---NNIIIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSI 152
             |..|....:|..:..   ..||.||.:|| ..:.|::|::|.:|..:|:.::.|.|..  ...:
Human   677 -GLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPD--ASHV 738

  Fly   153 DYVGSVATIAGFGYTEDEYLDYSET----LLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGS 213
            ...|....:.|:|:|:     |..|    |...::.:|:...|..:..:. :....||. ||...
Human   739 FPAGKAIWVTGWGHTQ-----YGGTGALILQKGEIRVINQTTCENLLPQQ-ITPRMMCV-GFLSG 796

  Fly   214 DMSTCTGDSGGPLI-------LYNKTIQQWQQIGINSFVAEDQCTYR-LPSGYARVSSFLGFIAD 270
            .:.:|.|||||||.       ::...:..|          .|.|..| .|..|.|:..|..:|.:
Human   797 GVDSCQGDSGGPLSSVEADGRIFQAGVVSW----------GDGCAQRNKPGVYTRLPLFRDWIKE 851

  Fly   271 KTGI 274
            .||:
Human   852 NTGV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 69/256 (27%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>162 CDD:460188
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 69/258 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.