DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG18754

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:265 Identity:67/265 - (25%)
Similarity:121/265 - (45%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNG--------- 84
            ::|:..|.   ...:|:|.::||.|:|   .:::.|   |:|  .:|||||||..|         
  Fly   100 TTPVFRDR---GAENAELNEYPWMVLL---LYENRL---SLI--RYVLTAAHCVIGGYLTQNDLV 153

  Fly    85 LSSIFLMFGTVDLFNANA----LNMTSNNIIIHPDYNDK---LNNDVSLIQLPEPLTFSANIQAI 142
            |.|:.|...|.|...:.:    |::......:|..:...   ..||::|::|..|:.::..||.|
  Fly   154 LKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPI 218

  Fly   143 QLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCA 207
            .|:.......|.   ...|:|:..|:.     |:||:.:.|:..:.|||:..|..:... |.:||
  Fly   219 CLLDAEFPLQDL---NLQISGWDPTKS-----SQTLITSTVKERNPADCLNRYPSFRSA-SQVCA 274

  Fly   208 KGFDGSDMSTCTGDSGGPLI-LYNKTIQQWQQI-GINSFVAEDQCTYRLPSGYARVSSFLGFIAD 270
            .|....|  ||.|.||.|:: :....:.::..: ||.|:..:...:..:|..|.::..|..:|  
  Fly   275 GGQRKGD--TCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI-- 335

  Fly   271 KTGIA 275
            |..:|
  Fly   336 KANLA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 62/248 (25%)
Tryp_SPc 38..271 CDD:238113 63/250 (25%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 64/250 (26%)
Tryp_SPc 108..335 CDD:214473 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.