DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and ctrb.3

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:237 Identity:73/237 - (30%)
Similarity:121/237 - (51%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN 101
            |||:|.:|....:||||.| :|......||||:|::.||:|||||:...|...:: |..:...:|
Zfish    33 RIVNGEEAVPHSWPWQVSL-QDFTGFHFCGGSLINEFWVVTAAHCSVRTSHRVIL-GEHNKGKSN 95

  Fly   102 A----LNMTSNNIIIHPDYN-DKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATI 161
            .    ..|..:.:..||.|| :.:.||::|::|..|.:.:|::..:.| .:..|:. ..|.....
Zfish    96 TQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCL-AEASDNF-ASGMTCVT 158

  Fly   162 AGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL 226
            :|:|.|....|...:.|....:.::.|.||...:|.. :.|:.:|| |..|:  |:|.|||||||
Zfish   159 SGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWGSN-IRDTMICA-GAAGA--SSCMGDSGGPL 219

  Fly   227 ILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            :.....|  |..:||.|: ...:|...:|..|.||:....::
Zfish   220 VCQKDNI--WTLVGIVSW-GSSRCDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/235 (31%)
Tryp_SPc 38..271 CDD:238113 72/236 (31%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 73/235 (31%)
Tryp_SPc 34..261 CDD:238113 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.