DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and ctrl

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:269 Identity:89/269 - (33%)
Similarity:138/269 - (51%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLAAISVVGQPF---DPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISD 72
            |.||:.|:::|..:   .||.|..:....|||:|.:|..|.:||||.| :|:.....||||:|||
 Frog     4 LWLLSCIALIGSTYGCGSPAISPVLSGYARIVNGENAVPGSWPWQVSL-QDSTGFHFCGGSVISD 67

  Fly    73 TWVLTAAHCTNGLSSIF-LMFGTVDLFN-ANAL-NMTSNNIIIHPDYND-KLNNDVSLIQLPEPL 133
            .||:|||||  |:::.. ::.|..|..: |..: ..|...:..||:||. .:.||::|::|..|.
 Frog    68 FWVVTAAHC--GVTTAHRVILGEYDRSSPAEPIQTKTIAKVFRHPNYNSFTIANDITLLKLSSPA 130

  Fly   134 TFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKY 198
            :|| ||.|...|....|:.: .|......|:||.:.........|....:.::.|.:|...:|..
 Frog   131 SFS-NIVAPVCVASSSDAFN-GGERCVTTGWGYVDAASRLTPNKLQQVALPLLSNTECQRYWGSK 193

  Fly   199 VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSS 263
            ::  :||...|..|:  |:|.|||||||:....  ..|...||.|: ....|:...|..|||||:
 Frog   194 IL--NTMVCAGASGA--SSCMGDSGGPLVCQRN--GAWVLAGIVSW-GSSTCSPSSPGVYARVST 251

  Fly   264 FLGFIADKT 272
            ...:: |:|
 Frog   252 LRSWM-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 79/234 (34%)
Tryp_SPc 38..271 CDD:238113 78/236 (33%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.