DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and ctrb2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:266 Identity:83/266 - (31%)
Similarity:134/266 - (50%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFD---PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIIS 71
            :|.||:.|.::|..:.   ||....|....|||:|.:|..|.:||||.| :|......||||:::
 Frog     3 LLFLLSCIVLIGSTYGCGVPAIKPIISGYARIVNGENAVSGSWPWQVSL-QDRTGFHFCGGSLVN 66

  Fly    72 DTWVLTAAHCTNGL-SSIFLMFGTVDLFNA--NALNMTSNNIIIHPDYN-DKLNNDVSLIQLPEP 132
            :.||:|||||  |: :|..::.|..|..::  ....|:.:.:..||:|| :.:.||::|::|...
 Frog    67 NLWVVTAAHC--GVTTSHRVILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMINDITLLKLSST 129

  Fly   133 LTFSANIQAIQLVGQYGDSIDYVGS----VATIAGFGYTEDEYLDYS-ETLLYAQVEIIDNADCV 192
            .:|::.:..:.:    ..|.:...|    :.|  |:||. |.|...| ..|....:.::.|.:|.
 Frog   130 ASFNSRVAPVCI----PTSSEVFNSPERCITT--GWGYV-DAYSKLSPNKLQQVTLPLLSNTECQ 187

  Fly   193 AIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSG 257
            ..:|.  .:.|||...|..|:  |:|.|||||||:....  ..|...||.|: ....|:...|..
 Frog   188 RYWGN--KIHSTMICAGASGA--SSCMGDSGGPLVCARN--GAWVLAGIVSW-GSSTCSPSSPGV 245

  Fly   258 YARVSS 263
            |||||:
 Frog   246 YARVST 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 75/236 (32%)
Tryp_SPc 38..271 CDD:238113 74/235 (31%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.