DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and prss27

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:250 Identity:77/250 - (30%)
Similarity:122/250 - (48%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHC---TNGLSSIFLMFGT- 94
            :.:||:.|..|:.||:||||..:.:...  .|||::||..:|::||||   ::..||:..:.|. 
 Frog    30 VSSRIMGGQSAQEGQWPWQVSFRNNGGH--FCGGTLISKQYVISAAHCFPSSSSASSVTAVLGAY 92

  Fly    95 -VDLFNANALNMTSNNIIIHPDY-NDKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDY-VG 156
             :|..:.|.:.:...:...:|.| |:..:.|:||:||..|:||:..|..:.|.   .|::.: .|
 Frog    93 MIDQPDGNQVAIPVQSATNYPSYVNEGDSGDISLVQLASPVTFTNYILPVCLP---ADTVTFPTG 154

  Fly   157 SVATIAGFG-YTEDEYLDYSETLLYAQVEIIDNADCVAIY---GKY----VVVDSTMCAKGFDGS 213
            ....:.|:| ...|..|....||....|.:||..:|.|:|   ..|    :.|.|.|...||...
 Frog   155 LQCWVTGWGNIASDVSLVSPMTLQEVAVPLIDANECNALYQTPNSYGTSSISVHSDMICAGFING 219

  Fly   214 DMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFI 268
            ...:|.|||||||:.  .:..||...|:.||.......|| |..|..:.|:..:|
 Frog   220 GKDSCQGDSGGPLVC--SSSGQWFLAGVVSFGEGCGQAYR-PGVYTLMPSYTDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 76/245 (31%)
Tryp_SPc 38..271 CDD:238113 75/245 (31%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 75/244 (31%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.