DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and MST1

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001380510.1 Gene:MST1 / 4485 HGNCID:7380 Length:737 Species:Homo sapiens


Alignment Length:227 Identity:60/227 - (26%)
Similarity:98/227 - (43%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIISDTWVLTAAHCTNG----LSSIFLMFGTVDLFNANALNMTSNNIIIHPDYND------- 118
            ||||::.:.|:|||..|.:.    |:...:..||  ||.             :|.:.:       
Human   533 CGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT--LFQ-------------NPQHGEPSLQRVP 582

  Fly   119 --KL-----NNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYV---GSVATIAGFGYTEDEYLD 173
              |:     .:.:.|::|...:|.:..:..|.|..::     ||   |:...|||:|.|:....|
Human   583 VAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEW-----YVVPPGTKCEIAGWGETKGTGND 642

  Fly   174 YSETLLYAQVEIIDNADC-VAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQ 237
              ..|..|.:.:|.|.:| :...|:  |.:|.||.:|. .:.:..|.||.||||..:  |...|.
Human   643 --TVLNVALLNVISNQECNIKHRGR--VRESEMCTEGL-LAPVGACEGDYGGPLACF--THNCWV 700

  Fly   238 QIGINSFVAEDQCT-YRLPSGYARVSSFLGFI 268
            ..||  .:....|. .|.|:.:.|||.|:.:|
Human   701 LEGI--IIPNRVCARSRWPAVFTRVSVFVDWI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 59/225 (26%)
MST1NP_001380510.1 PAN_AP_HGF 37..118 CDD:238532
KR 122..202 CDD:214527
KR 202..>241 CDD:412161
PHA03247 <234..457 CDD:223021
Tryp_SPc 527..733 CDD:238113 60/227 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.