DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and ctrl

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:259 Identity:84/259 - (32%)
Similarity:130/259 - (50%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFD---PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIIS 71
            ||.:::..::|.....   ||....|...||||:|.:|..|.:||||.|::..... .||||:|:
Zfish     1 MLWIISCFALVASTLGCGVPAIKPVISGYNRIVNGENAVSGSWPWQVSLQQSNGFH-FCGGSLIN 64

  Fly    72 DTWVLTAAHCTNGLSSIFLMFGTVDL-FNANALNMTS-NNIIIHPDYNDK-LNNDVSLIQLPEPL 133
            ..||:|||||.......:::.|..|. .:|.::.:.| ...|.||.||.: .|||::|::|..|.
Zfish    65 QYWVVTAAHCRVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSSPA 129

  Fly   134 TFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKY 198
            ..::.|..:.|... ..||. .|:.....|:|.|..  ......|....:.::..|.|...:|:.
Zfish   130 QLTSRISPVCLAAS-STSIP-SGTRCVTTGWGKTGS--TSSPRILQQTALPLLSPAQCKQYWGQN 190

  Fly   199 VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVS 262
            .:.|:.:||   ..|.:|:|.|||||||:.  ::...|.|:||.|:...| |..|.|:.|||||
Zfish   191 RITDAMICA---GASGVSSCQGDSGGPLVC--ESSGAWYQVGIVSWGTSD-CNVRTPAVYARVS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 77/229 (34%)
Tryp_SPc 38..271 CDD:238113 76/228 (33%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 77/229 (34%)
Tryp_SPc 32..257 CDD:238113 76/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.