DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CTRB2

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:266 Identity:83/266 - (31%)
Similarity:134/266 - (50%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLAAISVVGQPFD---PANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISD 72
            |.||:..:::|..|.   ||....:...:|||:|.||..|.:||||.| :|......||||:||:
Human     4 LWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSL-QDKTGFHFCGGSLISE 67

  Fly    73 TWVLTAAHCTNGLSSIFLMFGTVDL----FNANALNMTSNNIIIHPDYND-KLNNDVSLIQLPEP 132
            .||:|||||....|.: ::.|..|.    .|...|.:.  .:..:|.::. .:|||::|::|..|
Human    68 DWVVTAAHCGVRTSDV-VVAGEFDQGSDEENIQVLKIA--KVFKNPKFSILTVNNDITLLKLATP 129

  Fly   133 LTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGK 197
            ..||..:.|:.|..  .|.....|::....|:|.|:.......:.|..|.:.::.||:|...:|:
Human   130 ARFSQTVSAVCLPS--ADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGR 192

  Fly   198 YVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVS 262
            . :.|..:||   ..|.:|:|.|||||||:....  ..|..:||.|: ....|:...|:.||||:
Human   193 R-ITDVMICA---GASGVSSCMGDSGGPLVCQKD--GAWTLVGIVSW-GSRTCSTTTPAVYARVA 250

  Fly   263 SFLGFI 268
            ..:.::
Human   251 KLIPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 76/235 (32%)
Tryp_SPc 38..271 CDD:238113 75/236 (32%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 76/235 (32%)
Tryp_SPc 34..259 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.