DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:277 Identity:93/277 - (33%)
Similarity:137/277 - (49%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISD 72
            :|.:....||....|...|.....:||..||.:|..|..|:.|:.|.|......:..||||||.:
  Fly     8 ALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGN 72

  Fly    73 TWVLTAAHCTNGLSSIFLMFGTVDLFNANALN-------MTSNNIIIHPDYND-KLNNDVSLIQL 129
            ||||||||||||.|.:.:.:|      |:..|       :.|.|.:.|..||. .|:||:|||:.
  Fly    73 TWVLTAAHCTNGASGVTINYG------ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRT 131

  Fly   130 PEPLTFSANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVA 193
            |. :.|...:..::| ..|.|.. ||.|..|..:|:|.|.|. ....:.|....|:|:..:||..
  Fly   132 PH-VDFWHLVNKVEL-PSYNDRYQDYAGWWAVASGWGGTYDG-SPLPDWLQAVDVQIMSQSDCSR 193

  Fly   194 IYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGY 258
            .:..:   |:.:|.....|.  |||.|||||||:.:...    :.:|:.|||:...|....|:.:
  Fly   194 SWSLH---DNMICINTNGGK--STCGGDSGGPLVTHEGN----RLVGVTSFVSSAGCQSGAPAVF 249

  Fly   259 ARVSSFLGFIADKTGIA 275
            :||:.:|.:|.|.|||:
  Fly   250 SRVTGYLDWIRDNTGIS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 81/239 (34%)
Tryp_SPc 38..271 CDD:238113 81/241 (34%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 81/239 (34%)
Tryp_SPc 38..262 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471047
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.