DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:143/272 - (52%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFDPANSSPIK-IDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDT 73
            :.:.:||.:.|..|......:||| |..||.:|..|..|:.|:.|.|......:..||||||.:|
  Fly     7 LALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNT 71

  Fly    74 WVLTAAHCTNGLSSIFLMFGTVDLFNANALN-MTSNNIIIHPDYND-KLNNDVSLIQLPEPLTFS 136
            |||||||||||.|.:.:.:|..........: :.|.:||.|..||. .|:||:|||:.|. :.|.
  Fly    72 WVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPH-VDFW 135

  Fly   137 ANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTED--EYLDYSETLLYAQVEIIDNADCVAIYGKY 198
            :.:..::| ..|.|.. ||.|..|..:|:|.|.|  ...|:.:::   .|:||..:||...:..:
  Fly   136 SLVNKVEL-PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSV---DVQIISQSDCSRTWSLH 196

  Fly   199 VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSS 263
               |:.:|.....|.  |||.|||||||:.::..    :.:|:.||.:...|....|:.::||:.
  Fly   197 ---DNMICINTDGGK--STCGGDSGGPLVTHDGN----RLVGVTSFGSAAGCQSGAPAVFSRVTG 252

  Fly   264 FLGFIADKTGIA 275
            :|.:|.|.|||:
  Fly   253 YLDWIRDNTGIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 80/235 (34%)
Tryp_SPc 38..271 CDD:238113 80/237 (34%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471037
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.