DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG11843

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:286 Identity:85/286 - (29%)
Similarity:124/286 - (43%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAAISVVGQPFDPANS-SPIKIDNRIVSGSDAKLGQFPWQVILKR----DAWDDLLCGGSIISD 72
            ||...|:..:..|...| :|:     ||.|..|:..:||....|.|    .:..|..|||.:||:
  Fly    47 LLPGASIESRIIDNCRSYTPL-----IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISE 106

  Fly    73 TWVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTS------------NNIIIHPDYND-KLNNDV 124
            .:|||||||.....      |.|::.....|:..|            ...|.||.|.| :..:|:
  Fly   107 RFVLTAAHCLESER------GEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDI 165

  Fly   125 SLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNA 189
            .|::|.|.:.|........|..|...|.|...:|    |:|.| ...|..|..||..:::...|.
  Fly   166 GLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAV----GWGST-GLALKPSAQLLKVKLQRYGNW 225

  Fly   190 DCVAIYGKYVVVDSTMCAKGFD-------GSDMS--TCTGDSGGPLILYNKTIQ-QWQQIGINSF 244
            .|..:..:.|    ....:|||       ||:|:  ||.|||||||::|::... .:..:||.| 
  Fly   226 VCKKLLTRQV----EEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITS- 285

  Fly   245 VAEDQC-TYRLPSGYARVSSFLGFIA 269
             |...| :..:|..|.||..:||:||
  Fly   286 -AGLSCGSPGIPGIYTRVYPYLGWIA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 77/258 (30%)
Tryp_SPc 38..271 CDD:238113 79/260 (30%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/260 (30%)
Tryp_SPc 68..309 CDD:214473 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.