DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG11841

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:335 Identity:88/335 - (26%)
Similarity:131/335 - (39%) Gaps:101/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSLMLVLLAAIS-----VVGQPFDP-----------------------ANSSPIKIDN------- 36
            :||.|:||...|     |.||..||                       ...:||..:.       
  Fly     4 QSLELILLLVFSLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGS 68

  Fly    37 --RIVSGSDAKLGQFPWQVIL------KRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFG 93
              .||.|:.|:..:||:...|      ....|   .|||::||:..|||||||      .|...|
  Fly    69 RPLIVDGTPAEPKEFPFAARLGHRKTNNEIKW---FCGGTLISNRLVLTAAHC------FFSEHG 124

  Fly    94 TVDLFNANALNMTSNN------------IIIHPDY-NDKLNNDVSLIQLPEPLTFSANIQAIQLV 145
            .|::.....|...::.            :..||.: |.:|.||:.::||...:.|:.......| 
  Fly   125 EVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACL- 188

  Fly   146 GQYGDSIDYVGSVATIAGFG---YTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVD----- 202
             .:.|...:...:|  .|:|   :.:.|    |:.||..|::...:. ||:      .||     
  Fly   189 -PFDDGEQHESFIA--IGWGQKKFAQKE----SKKLLKVQLQGYKDR-CVS------SVDANDEL 239

  Fly   203 -------STMCAKGFDGSDMSTCTGDSGGPLILYNKTIQ-QWQQIGINSFVAEDQC-TYRLPSGY 258
                   |.:|....|..|  ||.||||||::.|:|.:. .:..:||.|  |...| |..:||.|
  Fly   240 PNGYEPKSQLCIGSRDNKD--TCNGDSGGPVLAYHKDLACMYHVMGITS--AGITCSTPDIPSAY 300

  Fly   259 ARVSSFLGFI 268
            .||..||.:|
  Fly   301 TRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 74/266 (28%)
Tryp_SPc 38..271 CDD:238113 75/267 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 75/267 (28%)
Tryp_SPc 72..310 CDD:214473 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.