DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG4815

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:219 Identity:61/219 - (27%)
Similarity:94/219 - (42%) Gaps:34/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLCGGSIISDTWVLTAAHCTNGL--SSIFLMFGTVDLFNANALNMTSNNII---IHPDY-NDKLN 121
            |:|..::::...:||||||...|  |...::.|....|..:..|...|.:|   |||.| ..|..
  Fly    59 LVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFI 123

  Fly   122 NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYS--ETLLYAQVE 184
            .||::.:...||. |..|...||.    .|:.:.......||:|: |....|.|  :|....:|.
  Fly   124 ADVAVAKTKYPLR-SKYIGYAQLC----RSVLHPRDKLIAAGWGF-EGGVWDESRKKTFRSMKVG 182

  Fly   185 IIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQ 249
            |:...||.....: .:..:.:||..::...:  |.|||||||:|..      |..|||::     
  Fly   183 IVSKRDCEKQLDR-KMPPNIICAGAYNNKTL--CFGDSGGPLLLGR------QVCGINTW----- 233

  Fly   250 CTYRL-----PSGYARVSSFLGFI 268
             |::.     |..|..|..:..||
  Fly   234 -TFKCGNNEKPDVYMGVRYYAKFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 59/217 (27%)
Tryp_SPc 38..271 CDD:238113 61/219 (28%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 61/219 (28%)
Trypsin 49..256 CDD:278516 59/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.