DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG5909

DIOPT Version :10

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:280 Identity:81/280 - (28%)
Similarity:128/280 - (45%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILKRDAWD--DLLCGGSIISDT 73
            |.||.:::..|...:|          ::..|..|:.|.|||..:||....|  ...||||:||:.
  Fly   113 LQLLNSVTNCGNKGNP----------KVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISER 167

  Fly    74 WVLTAAHC-TNGLSSIFLMFGTVDL---FNANALNMTS------------NNIIIHPDY-NDKLN 121
            .:|||||| .:....|.:..|..||   .:.:.|..|:            ..|.:||:| :.|::
  Fly   168 HILTAAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKIS 232

  Fly   122 NDVSLIQLPEPLTFSANIQAIQL-VGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEI 185
            :||::|:|...:...::|:.:.| :.|....:|:..|. .:||:|.||.|.:  :..|..|.:..
  Fly   233 HDVAIIKLDRVVKEKSHIKPVCLPIDQKSQELDFDQSF-FVAGWGGTEKETV--ATKLQQALITR 294

  Fly   186 IDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYN--KTIQQWQQIGINSFVAED 248
            ....:|...|.|..|.|:.:||.|  .....||.||||||:...:  |...:..|.|:.||... 
  Fly   295 KSLNECRQYYNKGEVSDNHICATG--TGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGR- 356

  Fly   249 QCTYRLPSGYARVSSFLGFI 268
            .|....|..:|.|...|.:|
  Fly   357 LCGQNQPGVFASVIDMLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 75/252 (30%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 132..379 CDD:238113 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.