DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and SPE

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:287 Identity:68/287 - (23%)
Similarity:117/287 - (40%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NRIVSGSDAKLGQFPWQVILK-RDAWDDLL---CGGSIISDTWVLTAAHCTNGLSSIFLMFGTVD 96
            :||..|::..|.:|||.|:|: :..:.:..   |||::::..:||||.||   |:|         
  Fly   133 DRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHC---LAS--------- 185

  Fly    97 LFNANALNMTSNNIIIH------------PDYNDKLN---------------------------- 121
                  ..:..:..::|            ||...::|                            
  Fly   186 ------RELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSV 244

  Fly   122 ---NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQV 183
               ||::|::|...::::..::.|.|........::|.....:||:|.||:  :..|...|...|
  Fly   245 DQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTEN--MQPSAIKLKITV 307

  Fly   184 EIIDNADCVAIYGKYVVV--DSTMCAKGFDGSDMSTCTGDSGGPLILYNKT--IQQWQQIGINSF 244
            .:.:...|...|..:.|.  ||.|||.|..|.|  ||.|||||||::...|  ...:...|:.|:
  Fly   308 NVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVD--TCGGDSGGPLMVPISTGGRDVFYIAGVTSY 370

  Fly   245 VAEDQCTYRLPSGYARVSSFLGFIADK 271
            ..:.......|..|.|..:|:.:|..|
  Fly   371 GTKPCGLKGWPGVYTRTGAFIDWIKQK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 66/281 (23%)
Tryp_SPc 38..271 CDD:238113 66/283 (23%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 66/283 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.