DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG31199

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:240 Identity:49/240 - (20%)
Similarity:85/240 - (35%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIISDTWVLTAAHC---TNGLSSIFLMFGTVDLFNANA-----------------LNMTSNN 109
            |.|.::|...||..|||   .||::..|.:.  :.:.|.:|                 ..:....
  Fly    71 CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVH--LGVHNKSAPVGVRVCETDGYCVRPSQEIKLAE 133

  Fly   110 IIIHPDYNDK-LNNDVSLIQLPEPLTFSANIQAI-----QLVGQYGDSIDYVGSVATIAGFGYTE 168
            |.|||||:.: |.|.::::.|........|:..|     .|:.:     ..|.....:||....|
  Fly   134 IAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNE-----TLVAQTFVVAGLRVFE 193

  Fly   169 DEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNK-- 231
            |       ..|...|..:....|.:.....|...:|:|  |:....::...   |.||:...|  
  Fly   194 D-------FRLKTWVNTLSRGFCQSKVKTLVTSSNTVC--GYHKQPVAYYL---GAPLVGLQKKG 246

  Fly   232 -TIQQWQQIGI-------NSFVAEDQCTYRLPSGYARVSSFLGFI 268
             ..|.:..:||       |:         |:.|.:..:.:::.||
  Fly   247 HVTQNYYLVGIMIDWRWENN---------RIMSSFLAIRNYMDFI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 47/238 (20%)
Tryp_SPc 38..271 CDD:238113 49/240 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 42/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.