DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG31219

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:129/264 - (48%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIVSGSDAKLGQFPWQVILKRDAWDDL----LCGGSIISDTWVLTAAHCTNG----LSSIFLMFG 93
            |:|.||:|:...:||..:|.......|    .|.||:|::.:|||:|||.||    ||...:..|
  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152

  Fly    94 TVDL-----FNANA-----------LNMTSNNIIIHPDY----NDKLNNDVSLIQLPEPLTFSAN 138
            ..|:     :|.:.           |.:....||:|..:    |..:..|::|::|..|:.:...
  Fly   153 EHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTG 217

  Fly   139 IQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDS 203
            |..| .:.::|   .:..|...|||:|.|.:.  .:|:.|::..:.....|.| |:...|:.::.
  Fly   218 IMPI-CIPKHG---FFAKSKLEIAGWGKTNEG--QFSQVLMHGFIRERSIAVC-ALRFPYLDLNQ 275

  Fly   204 TM--CAKGFDGSDMSTCTGDSGGPLI--LYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSF 264
            ::  ||.|:||.|  ||.|||||||:  :.|.::   ...||.::.:::.....:|..|.|.|:|
  Fly   276 SLQICAGGYDGVD--TCQGDSGGPLMVTMDNSSV---YLAGITTYGSKNCGQIGIPGIYTRTSAF 335

  Fly   265 LGFI 268
            |.:|
  Fly   336 LPWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 74/262 (28%)
Tryp_SPc 38..271 CDD:238113 74/263 (28%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 74/262 (28%)
Tryp_SPc 90..342 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.