DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG5246

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:134/277 - (48%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLAAISVVGQPFDPANSSPIKI---------------DNRIVSGSDAKLGQFPWQVILKRDAW 60
            |||::.:.::.|    .::..:||               :.|::.|.|:..|..|:||.: .:.:
  Fly     4 LVLISVLVILSQ----CSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSI-MNTF 63

  Fly    61 DDLLCGGSIISDTWVLTAAHCTN-GLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDK--LNN 122
            .:.:||||||:..|:||||||.. .:..:.::.||||.....|..:...: .||..: ||  .:|
  Fly    64 GEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGS-KIHCSH-DKPAYHN 126

  Fly   123 DVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIID 187
            |::||...:|:.:....|.|:|..:  .|:..||...|:.|:|.|: .:..||..|....:..||
  Fly   127 DIALIHTAKPIVYDDLTQPIKLASK--GSLPKVGDKLTLTGWGSTK-TWGRYSTQLQKIDLNYID 188

  Fly   188 NADCVA-IYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCT 251
            :.:|.: :.....:.:..:|.  |......:|.|||||||:..|:|:     :|:.::  .:.|.
  Fly   189 HDNCQSRVRNANWLSEGHVCT--FTQEGEGSCHGDSGGPLVDANQTL-----VGVVNW--GEACA 244

  Fly   252 YRLPSGYARVSSFLGFI 268
            ...|..:..|:.:..:|
  Fly   245 IGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 66/234 (28%)
Tryp_SPc 38..271 CDD:238113 66/235 (28%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/234 (28%)
Tryp_SPc 42..263 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436910
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.