DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG17475

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:111/266 - (41%) Gaps:71/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFL--MFGT 94
            :...||:::|.|.:||:..:|:.| :..:...:|||.||.:..|||||||..|.:..:|  :.||
  Fly    44 VNFQNRVINGEDVQLGEAKYQISL-QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGT 107

  Fly    95 VDLFNANALNMTSNNIIIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQL----VGQYGDSIDY 154
            |:....:|:.....: .||.:||. ..:||::||:|.:.:.|:...|..:|    |..       
  Fly   108 VEYEKPDAVYFVEEH-WIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVAN------- 164

  Fly   155 VGSVATIAGFGYTE----------DEYLDYSETLLYAQVEIIDNAD--------CVAIYGKYVVV 201
             |:...:.|:|.||          ..||.:   ::|:..:.|.|.|        |....|     
  Fly   165 -GTQLLLTGWGSTELWGDTPDILQKAYLTH---VVYSTCQEIMNNDPSNGPCHICTLTTG----- 220

  Fly   202 DSTMCAKGFDGSDMSTCTGDSGGPL----ILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVS 262
                        ....|.|||||||    :||.  :..|..          .|...:|..:|.|.
  Fly   221 ------------GQGACHGDSGGPLTHNGVLYG--LVNWGY----------PCALGVPDSHANVY 261

  Fly   263 SFLGFI 268
            .:|.:|
  Fly   262 YYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/259 (26%)
Tryp_SPc 38..271 CDD:238113 67/260 (26%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 67/259 (26%)
Tryp_SPc 50..269 CDD:238113 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.