DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG17477

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:112/237 - (47%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNG--LSSIFLMFGT 94
            :.:::.||.|.:|..|..|:||.| :......||||:||||.|::||.||..|  .|.:.:..||
  Fly    21 LALEHFIVGGQNAAEGDAPYQVSL-QTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGT 84

  Fly    95 VDLFNANALNMTSNNIIIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSV 158
            :......|: ...:.|.:|.:|:. |..||:.|:.|.|.:||:|..||::|.   ........|.
  Fly    85 IRYAEPGAV-YYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP---TSPFPRGASE 145

  Fly   159 ATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVD---STMCAKGFDGSDMSTCTG 220
            ....|:| ::.........|...|.:.:::..|.::...|..::   ..:||  :..:::..|.|
  Fly   146 LVFTGWG-SQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA--YRQANIGACHG 207

  Fly   221 DSGGPLILYNKTIQQWQQIGI-NSFVAEDQCTYRLPSGYARV 261
            ||||||      :.|...:|| |.||   .|...:|..:..:
  Fly   208 DSGGPL------VHQGTLVGILNFFV---PCAQGVPDIFMNI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/232 (29%)
Tryp_SPc 38..271 CDD:238113 67/231 (29%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 67/231 (29%)
Tryp_SPc 27..246 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.