DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and modSP

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:277 Identity:63/277 - (22%)
Similarity:86/277 - (31%) Gaps:86/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSPIK--------IDNRIVSGSDAKLGQFPWQVILKRDAWDD-----LLCGGSIISDTWVLTAAH 80
            ::|||        |:|.:|          ||.|.|.  .|.:     ..||||:::...|:||||
  Fly   362 ATPIKQFSSGGYTINNTVV----------PWHVGLY--VWHNEKDYHFQCGGSLLTPDLVITAAH 414

  Fly    81 CT--NGLSSIFLMFGTVDLFNANALNMTSNN--------------IIIHPDYNDKLNN---DVSL 126
            |.  .|....:    :.|.|...|.....|.              |.|.|.|..:..|   |::|
  Fly   415 CVYDEGTRLPY----SYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLAL 475

  Fly   127 IQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADC 191
            :.|.||...|..|:.|               ..|.|.|...|....|.........:|.......
  Fly   476 LTLDEPFELSHVIRPI---------------CVTFASFAEKESVTDDVQGKFAGWNIENKHELQF 525

  Fly   192 VAIYGKYVVVDSTMCAKG-----------FDGSDMSTCTGDSGGPLI--LYNKTIQQWQQ----- 238
            |....|    .:::|.:.           |.......|.|||||...  |.......|..     
  Fly   526 VPAVSK----SNSVCRRNLRDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFL 586

  Fly   239 IGINSFVAE-DQCTYRL 254
            .|:.|.... |||.:.|
  Fly   587 FGVISNAPNADQCAHSL 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 58/261 (22%)
Tryp_SPc 38..271 CDD:238113 58/260 (22%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 60/268 (22%)
Tryp_SPc 371..591 CDD:304450 55/254 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.