DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG3505

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:294 Identity:70/294 - (23%)
Similarity:121/294 - (41%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVILK--RDAWDDL-LCGGSIISDTWVL 76
            |.:..:..|..|::...::....  :.:|.::.:|||..:::  |...:.: .|||.:|||.:||
  Fly    86 AGLGALTHPLLPSDCGKVRWQRS--NDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVL 148

  Fly    77 TAAHC-----TNGLSSIFLMFGTVDLFNANALNMTSNN-------------------------II 111
            |||||     |:.|....:..|..|         ||.|                         ::
  Fly   149 TAAHCVAQAATSNLQITAVRLGEWD---------TSTNPDCQYHEDSKVADCAPPYQDIAIEELL 204

  Fly   112 IHPDYN--DKLN-NDVSLIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLD 173
            .||.||  |:.. ||::|::|..|...:..:|.|.|..:...:.:....|..:||:..:.     
  Fly   205 PHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQASS----- 264

  Fly   174 YSETLLYAQVEIIDNADCVAIYG--KYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQW 236
             |:.:....|.|....:|...|.  :..:..|.:|  |...|  ..|.|::||||:|:..  ..:
  Fly   265 -SQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNS--QECYGNAGGPLMLFKN--DGY 322

  Fly   237 QQIGINSFVAEDQCTYRLPSGYARVSSFLGFIAD 270
            ...|:.||..........|..|.||:|::.:|.|
  Fly   323 LLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 65/268 (24%)
Tryp_SPc 38..271 CDD:238113 67/271 (25%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 66/265 (25%)
Tryp_SPc 111..354 CDD:214473 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.