DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG13318

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:294 Identity:80/294 - (27%)
Similarity:127/294 - (43%) Gaps:63/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQPFDPANSSPIKIDNRIVS-----------------GS------DAKLGQFPWQVILKRDAWDD 62
            |.|..|..||.:.....:|:                 ||      .|..|.:|||..|...| |.
  Fly   123 GYPTVPTTSSTLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTA-DV 186

  Fly    63 LLCGGSIISDTWVLTAAH--CTNGLSSIFLMFGTVDLFNAN----ALNMTSNNIIIHPDYN-DKL 120
            .|.||::|:...||||||  ...||:...:..|..|..:.:    |.::..:|:.::|.:| :.|
  Fly   187 YLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNL 251

  Fly   121 NNDVSLIQLPEP--LTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQV 183
            .|||::::|..|  ||..:.:..:.|     .:..:||....:||:|..     |:..|..|..:
  Fly   252 QNDVAILKLSTPVSLTSKSTVGTVCL-----PTTSFVGQRCWVAGWGKN-----DFGATGAYQAI 306

  Fly   184 E------IIDNADCVAI-----YGKYVVVDST--MCAKGFDGSDMSTCTGDSGGPLILYNKTIQQ 235
            |      :|.||:|.|.     .|...|:..|  :||.|..|.|  .||||.|.||:..:..:  
  Fly   307 ERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKD--ACTGDGGSPLVCTSNGV-- 367

  Fly   236 WQQIGINSFVAEDQCTYR-LPSGYARVSSFLGFI 268
            |..:|:.::..  .|... :|..|..|.::|.:|
  Fly   368 WYVVGLVAWGI--GCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 74/276 (27%)
Tryp_SPc 38..271 CDD:238113 75/277 (27%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 72/248 (29%)
Tryp_SPc 169..399 CDD:214473 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.