DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG7542

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:134/273 - (49%) Gaps:27/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFDPANSSPI--KIDNRIVSGSDAKLGQFPWQVIL-----KRDAWDDLLCGG 67
            |:.||..:.:||.    ..:.|:  .::..|.:|..|::||||:|..|     ....|    |||
  Fly     1 MMKLLVCVLLVGS----CTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTW----CGG 57

  Fly    68 SIISDTWVLTAAHCTNGLSSIFLMFGTVDLFNAN-----ALNMTSNNIIIHPDY-NDKLNNDVSL 126
            ::||..|::|||||.:|..|:.:..|.:::.:.:     .:.:..:.||:|.:| ...:.||:||
  Fly    58 TLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISL 122

  Fly   127 IQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIA-GFGYTEDEYLDYSETLLYAQVEIIDNAD 190
            |:||..:.|:..|:|..|..:.........|:...| |:|...|.....|..|.|.::.|:.::.
  Fly   123 IRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSL 187

  Fly   191 CVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLP 255
            | .:|....|.:..:|.....|.  |||.|||||||: |.:....: .||..||.....|....|
  Fly   188 C-RMYWSGAVSEKMICMSTTSGK--STCHGDSGGPLV-YKQGNSSY-LIGSTSFGTSMGCQVGFP 247

  Fly   256 SGYARVSSFLGFI 268
            :.:.|:||:|.:|
  Fly   248 AVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 74/242 (31%)
Tryp_SPc 38..271 CDD:238113 75/243 (31%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 75/243 (31%)
Tryp_SPc 27..260 CDD:214473 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471032
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.