DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG11529

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:134/250 - (53%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PIKIDNRIVSGSD-AKLGQFPWQVIL-KRDAW-DDLLCGGSIISDTWVLTAAHCTNGLSSIFLMF 92
            |...|:..|..|. .::.:||:||:| .:..| ..:||||:::...|:|||.|||.|::...:..
  Fly    22 PTPTDSYAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYL 86

  Fly    93 GT---VDLFNANALNMTSNNIIIHPDYN-DKLNNDVSLIQLPEPLTFSANIQAIQLVGQYGDSID 153
            ||   .|...:..|.:.||..|:|..:| :...||::|::||:.:.|:..||...|..:|... .
  Fly    87 GTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHD-Q 150

  Fly   154 YVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDMSTC 218
            :.|.....:|:|...:  :..|:::.|.::::|.||:|...|.  ||....:||||.  .|.:.|
  Fly   151 FAGMSVVASGWGAMVE--MTNSDSMQYTELKVISNAECAQEYD--VVTSGVICAKGL--KDETVC 209

  Fly   219 TGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFIADKTG 273
            ||||||||:|.:..|    .:||.||...|.|...:|.|:.||:.:|.:|..|.|
  Fly   210 TGDSGGPLVLKDTQI----VVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 78/237 (33%)
Tryp_SPc 38..271 CDD:238113 79/239 (33%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 77/231 (33%)
Tryp_SPc 37..255 CDD:214473 76/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.