DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8952 and CG18180

DIOPT Version :9

Sequence 1:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:280 Identity:87/280 - (31%)
Similarity:141/280 - (50%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MLVLLAAISVVGQPFDPANSSPIKI----------DNRIVSGSDAKLGQFPWQV--ILKRDAWDD 62
            :|.|.||:::|.       :||..:          :.|||:|..|..|:.|:.|  .::.|..:.
  Fly     5 LLTLSAALALVA-------ASPTGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNS 62

  Fly    63 LLCG-GSIISDTWVLTAAHCTNGLSSIFLMFGTVDLFN-ANALNMTSNNIIIHPDYNDKLNNDVS 125
            ...| |:||::.|:||||||..| ..:.:.:|:...:| |....:..:|.|.|||:..:...|:.
  Fly    63 GAVGAGTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGRDIG 126

  Fly   126 LIQLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNAD 190
            ||:.|. :.|:..|..|.|......:..|..:.....|:|..::..|  ::.|....|:||.|::
  Fly   127 LIRTPH-VDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNL--ADWLQCVDVQIISNSE 188

  Fly   191 CVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLP 255
            |...||.  |..:.||.:..||.  |.|.|||||||:.::..    :.:|:.:| |...| :..|
  Fly   189 CEQAYGS--VASTDMCTRHADGK--SVCGGDSGGPLVTHDNA----RLVGVITF-ASVSC-HDGP 243

  Fly   256 SGYARVSSFLGFIADKTGIA 275
            |||.|||.:|.:|.|:|||:
  Fly   244 SGYTRVSDYLEWIRDQTGIS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 75/234 (32%)
Tryp_SPc 38..271 CDD:238113 75/236 (32%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 75/234 (32%)
Tryp_SPc 36..259 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.